SCOPe 2.05: Domain d1t2fd1: 1t2f D:1-160

Lineage for d1t2fd1 (1t2f D:1-160)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)

6. Protein Lactate dehydrogenase [51859] (17 species)

7. Species Human (Homo sapiens), heart isoform (H chain) [TaxId:9606] [63939] (2 PDB entries)

8. Domain d1t2fd1: 1t2f D:1-160 [99094]
   Other proteins in same PDB: d1t2fa2, d1t2fb2, d1t2fc2, d1t2fd2
   complexed with nad, oxq

Details for d1t2fd1

PDB Entry: 1t2f, 3 Å

PDB Description: human b lactate dehydrogenase complexed with nad+ and 4-hydroxy-1,2,5- oxadiazole-3-carboxylic acid

PDB Compounds: (D:) L-lactate dehydrogenase B chain

SCOPe Domain Sequences for d1t2fd1:

Sequence; same for both SEQRES and ATOM records:

>d1t2fd1 c.2.1.5 (D:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]}
atlkekliapvaeeeatvpnnkitvvgvgqvgmacaisilgksladelalvdvledklkg
emmdlqhgslflqtpkivadkdysvtanskivvvtagvrqqegesrlnlvqrnvnvfkfi
ipqivkyspdciiivvsnpvdiltyvtwklsglpkhrvig

Timeline for d1t2fd1:

• d1t2fd1 first appeared in SCOP 1.67
  
• d1t2fd1 appears in SCOPe 2.04
  
• d1t2fd1 appears in SCOPe 2.06
  
• d1t2fd1 appears in the current release, SCOPe 2.08