Lineage for d1t2fc1 (1t2f C:1-160)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 387036Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 387037Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families) (S)
  5. 388231Family c.2.1.5: LDH N-terminal domain-like [51848] (7 proteins)
  6. 388242Protein Lactate dehydrogenase [51859] (13 species)
  7. 388263Species Human (Homo sapiens), heart isoform (H chain) [TaxId:9606] [63939] (2 PDB entries)
  8. 388268Domain d1t2fc1: 1t2f C:1-160 [99092]
    Other proteins in same PDB: d1t2fa2, d1t2fb2, d1t2fc2, d1t2fd2

Details for d1t2fc1

PDB Entry: 1t2f (more details), 3 Å

PDB Description: human b lactate dehydrogenase complexed with nad+ and 4-hydroxy-1,2,5- oxadiazole-3-carboxylic acid

SCOP Domain Sequences for d1t2fc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t2fc1 c.2.1.5 (C:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain)}
atlkekliapvaeeeatvpnnkitvvgvgqvgmacaisilgksladelalvdvledklkg
emmdlqhgslflqtpkivadkdysvtanskivvvtagvrqqegesrlnlvqrnvnvfkfi
ipqivkyspdciiivvsnpvdiltyvtwklsglpkhrvig

SCOP Domain Coordinates for d1t2fc1:

Click to download the PDB-style file with coordinates for d1t2fc1.
(The format of our PDB-style files is described here.)

Timeline for d1t2fc1: