Lineage for d1t2ea1 (1t2e A:18-163)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2105555Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
  6. 2105594Protein Lactate dehydrogenase [51859] (18 species)
  7. 2105772Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [51863] (14 PDB entries)
  8. 2105780Domain d1t2ea1: 1t2e A:18-163 [99086]
    Other proteins in same PDB: d1t2ea2, d1t2ea3
    complexed with gol, nai, oxm; mutant

Details for d1t2ea1

PDB Entry: 1t2e (more details), 1.85 Å

PDB Description: plasmodium falciparum lactate dehydrogenase s245a, a327p mutant complexed with nadh and oxamate
PDB Compounds: (A:) l-lactate dehydrogenase

SCOPe Domain Sequences for d1t2ea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t2ea1 c.2.1.5 (A:18-163) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
apkakivlvgsgmiggvmatlivqknlgdvvlfdivknmphgkaldtshtnvmaysnckv
sgsntyddlagadvvivtagftkapgksdkewnrddllplnnkimieigghikkncpnaf
iivvtnpvdvmvqllhqhsgvpknkiigl

SCOPe Domain Coordinates for d1t2ea1:

Click to download the PDB-style file with coordinates for d1t2ea1.
(The format of our PDB-style files is described here.)

Timeline for d1t2ea1: