SCOPe 2.07: Domain d1t2da1: 1t2d A:1-150

Lineage for d1t2da1 (1t2d A:1-150)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)

6. Protein Lactate dehydrogenase [51859] (19 species)

7. Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [51863] (14 PDB entries)

8. Domain d1t2da1: 1t2d A:1-150 [99084]
   Other proteins in same PDB: d1t2da2
   complexed with gol, nad, oxl

Details for d1t2da1

PDB Entry: 1t2d, 1.1 Å

PDB Description: Plasmodium falciparum lactate dehydrogenase complexed with NAD+ and oxalate

PDB Compounds: (A:) l-lactate dehydrogenase

SCOPe Domain Sequences for d1t2da1:

Sequence; same for both SEQRES and ATOM records:

>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
apkakivlvgsgmiggvmatlivqknlgdvvlfdivknmphgkaldtshtnvmaysnckv
sgsntyddlagadvvivtagftkapgksdkewnrddllplnnkimieigghikkncpnaf
iivvtnpvdvmvqllhqhsgvpknkiiglg

Timeline for d1t2da1:

• d1t2da1 first appeared in SCOP 1.67
  
• d1t2da1 appears in SCOPe 2.06
  
• d1t2da1 appears in the current release, SCOPe 2.08