Lineage for d1t2da1 (1t2d A:1-150)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2452663Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
  6. 2452702Protein Lactate dehydrogenase [51859] (19 species)
  7. 2453012Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [51863] (14 PDB entries)
  8. 2453013Domain d1t2da1: 1t2d A:1-150 [99084]
    Other proteins in same PDB: d1t2da2
    complexed with gol, nad, oxl

Details for d1t2da1

PDB Entry: 1t2d (more details), 1.1 Å

PDB Description: Plasmodium falciparum lactate dehydrogenase complexed with NAD+ and oxalate
PDB Compounds: (A:) l-lactate dehydrogenase

SCOPe Domain Sequences for d1t2da1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
apkakivlvgsgmiggvmatlivqknlgdvvlfdivknmphgkaldtshtnvmaysnckv
sgsntyddlagadvvivtagftkapgksdkewnrddllplnnkimieigghikkncpnaf
iivvtnpvdvmvqllhqhsgvpknkiiglg

SCOPe Domain Coordinates for d1t2da1:

Click to download the PDB-style file with coordinates for d1t2da1.
(The format of our PDB-style files is described here.)

Timeline for d1t2da1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1t2da2