Lineage for d1t26a1 (1t26 A:19-163)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 819418Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 819419Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 821465Family c.2.1.5: LDH N-terminal domain-like [51848] (8 proteins)
  6. 821504Protein Lactate dehydrogenase [51859] (14 species)
  7. 821556Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [51863] (9 PDB entries)
  8. 821560Domain d1t26a1: 1t26 A:19-163 [99073]
    Other proteins in same PDB: d1t26a2
    complexed with gbd, nai

Details for d1t26a1

PDB Entry: 1t26 (more details), 1.8 Å

PDB Description: Plasmodium falciparum lactate dehydrogenase complexed with NADH and 4-hydroxy-1,2,5-thiadiazole-3-carboxylic acid
PDB Compounds: (A:) l-lactate dehydrogenase

SCOP Domain Sequences for d1t26a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t26a1 c.2.1.5 (A:19-163) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
pkakivlvgsgmiggvmatlivqknlgdvvlfdivknmphgkaldtshtnvmaysnckvs
gsntyddlagadvvivtagftkapgksdkewnrddllplnnkimieigghikkncpnafi
ivvtnpvdvmvqllhqhsgvpknkiigl

SCOP Domain Coordinates for d1t26a1:

Click to download the PDB-style file with coordinates for d1t26a1.
(The format of our PDB-style files is described here.)

Timeline for d1t26a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1t26a2