SCOP 1.73: Domain d1t25a1: 1t25 A:18-163

Lineage for d1t25a1 (1t25 A:18-163)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)

5. Family c.2.1.5: LDH N-terminal domain-like [51848] (8 proteins)

6. Protein Lactate dehydrogenase [51859] (14 species)

7. Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [51863] (9 PDB entries)

8. Domain d1t25a1: 1t25 A:18-163 [99071]
   Other proteins in same PDB: d1t25a2
   complexed with gag, gol, nai

Details for d1t25a1

PDB Entry: 1t25, 1.9 Å

PDB Description: Plasmodium falciparum lactate dehydrogenase complexed with NADH and 3-hydroxyisoxazole-4-carboxylic acid

PDB Compounds: (A:) l-lactate dehydrogenase

SCOP Domain Sequences for d1t25a1:

Sequence; same for both SEQRES and ATOM records:

>d1t25a1 c.2.1.5 (A:18-163) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
apkakivlvgsgmiggvmatlivqknlgdvvlfdivknmphgkaldtshtnvmaysnckv
sgsntyddlagadvvivtagftkapgksdkewnrddllplnnkimieigghikkncpnaf
iivvtnpvdvmvqllhqhsgvpknkiigl

Timeline for d1t25a1:

• d1t25a1 first appeared in SCOP 1.67
  
• d1t25a1 appears in SCOP 1.71
  
• d1t25a1 appears in SCOP 1.75
  
• d1t25a1 appears in the current release, SCOPe 2.08