Lineage for d1t24a2 (1t24 A:164-329)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1680346Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 1680347Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 1680348Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 1680355Protein Lactate dehydrogenase [56339] (19 species)
  7. 1680472Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [56343] (13 PDB entries)
  8. 1680476Domain d1t24a2: 1t24 A:164-329 [99070]
    Other proteins in same PDB: d1t24a1
    complexed with gol, nad, oxq

Details for d1t24a2

PDB Entry: 1t24 (more details), 1.7 Å

PDB Description: Plasmodium falciparum lactate dehydrogenase complexed with NAD+ and 4-hydroxy-1,2,5-oxadiazole-3-carboxylic acid
PDB Compounds: (A:) l-lactate dehydrogenase

SCOPe Domain Sequences for d1t24a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t24a2 d.162.1.1 (A:164-329) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
ggvldtsrlkyyisqklnvcprdvnahivgahgnkmvllkryitvggiplqefinnklis
daeleaifdrtvntaleivnlhaspyvapaaaiiemaesylkdlkkvlicstllegqygh
sdifggtpvvlgangveqvielqlnseekakfdeaiaetkrmkala

SCOPe Domain Coordinates for d1t24a2:

Click to download the PDB-style file with coordinates for d1t24a2.
(The format of our PDB-style files is described here.)

Timeline for d1t24a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1t24a1