Lineage for d1t24a1 (1t24 A:18-163)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 387036Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 387037Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families) (S)
  5. 388231Family c.2.1.5: LDH N-terminal domain-like [51848] (7 proteins)
  6. 388242Protein Lactate dehydrogenase [51859] (13 species)
  7. 388286Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [51863] (9 PDB entries)
  8. 388290Domain d1t24a1: 1t24 A:18-163 [99069]
    Other proteins in same PDB: d1t24a2
    complexed with gol, nad, oxq

Details for d1t24a1

PDB Entry: 1t24 (more details), 1.7 Å

PDB Description: Plasmodium falciparum lactate dehydrogenase complexed with NAD+ and 4-hydroxy-1,2,5-oxadiazole-3-carboxylic acid

SCOP Domain Sequences for d1t24a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t24a1 c.2.1.5 (A:18-163) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum)}
apkakivlvgsgmiggvmatlivqknlgdvvlfdivknmphgkaldtshtnvmaysnckv
sgsntyddlagadvvivtagftkapgksdkewnrddllplnnkimieigghikkncpnaf
iivvtnpvdvmvqllhqhsgvpknkiigl

SCOP Domain Coordinates for d1t24a1:

Click to download the PDB-style file with coordinates for d1t24a1.
(The format of our PDB-style files is described here.)

Timeline for d1t24a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1t24a2