Lineage for d1t15a1 (1t15 A:1649-1757)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 480638Fold c.15: BRCT domain [52112] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 480639Superfamily c.15.1: BRCT domain [52113] (4 families) (S)
  5. 480652Family c.15.1.3: Breast cancer associated protein, BRCA1 [63955] (1 protein)
  6. 480653Protein Breast cancer associated protein, BRCA1 [63956] (2 species)
    duplication: tandem repeat of BRCT domain
  7. 480654Species Human (Homo sapiens) [TaxId:9606] [63957] (7 PDB entries)
  8. 480655Domain d1t15a1: 1t15 A:1649-1757 [99067]

Details for d1t15a1

PDB Entry: 1t15 (more details), 1.85 Å

PDB Description: Crystal Structure of the Brca1 BRCT Domains in Complex with the Phosphorylated Interacting Region from Bach1 Helicase

SCOP Domain Sequences for d1t15a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t15a1 c.15.1.3 (A:1649-1757) Breast cancer associated protein, BRCA1 {Human (Homo sapiens)}
rmsmvvsgltpeefmlvykfarkhhitltnliteetthvvmktdaefvcertlkyflgia
ggkwvvsyfwvtqsikerkmlnehdfevrgdvvngrnhqgpkraresqd

SCOP Domain Coordinates for d1t15a1:

Click to download the PDB-style file with coordinates for d1t15a1.
(The format of our PDB-style files is described here.)

Timeline for d1t15a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1t15a2