Lineage for d1t0ya_ (1t0y A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 407834Fold d.15: beta-Grasp (ubiquitin-like) [54235] (11 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 407835Superfamily d.15.1: Ubiquitin-like [54236] (6 families) (S)
  5. 407836Family d.15.1.1: Ubiquitin-related [54237] (14 proteins)
  6. 407917Protein Ubiquitin-like domain of tubulin folding cofactor B [102786] (1 species)
  7. 407918Species Nematode (Caenorhabditis elegans) [TaxId:6239] [102787] (1 PDB entry)
  8. 407919Domain d1t0ya_: 1t0y A: [99066]

Details for d1t0ya_

PDB Entry: 1t0y (more details)

PDB Description: solution structure of a ubiquitin-like domain from tubulin-binding cofactor b

SCOP Domain Sequences for d1t0ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t0ya_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Nematode (Caenorhabditis elegans)}
mtevydleittnatdfpmekkypagmslndlkkklelvvgttvdsmriqlfdgddqlkge
ltdgakslkdlgvrdgyrihavdvtggned

SCOP Domain Coordinates for d1t0ya_:

Click to download the PDB-style file with coordinates for d1t0ya_.
(The format of our PDB-style files is described here.)

Timeline for d1t0ya_: