SCOP 1.73: Domain d1t0ub_: 1t0u B:

Lineage for d1t0ub_ (1t0u B:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (7 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (1 family)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.1: Purine and uridine phosphorylases [53168] (6 proteins)

6. Protein Uridine phosphorylase [53176] (2 species)

7. Species Escherichia coli [TaxId:562] [53177] (13 PDB entries)
   also includes the PDB entry (1rxs) where protein chains are designated by both upper case and lower case letters creating problems with its processing and presentation in SCOP

8. Domain d1t0ub_: 1t0u B: [99065]

Details for d1t0ub_

PDB Entry: 1t0u, 2.2 Å

PDB Description: Crystal structure of E.coli uridine phosphorylase at 2.2 A resolution (Type-A Native)

PDB Compounds: (B:) Uridine phosphorylase

SCOP Domain Sequences for d1t0ub_:

Sequence; same for both SEQRES and ATOM records:

>d1t0ub_ c.56.2.1 (B:) Uridine phosphorylase {Escherichia coli [TaxId: 562]}
ksdvfhlgltkndlqgatlaivpgdpdrvekiaalmdkpvklashrefttwraeldgkpv
ivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslh
faplefpavadfecttalveaaksigatthvgvtassdtfypgqerydtysgrvvrhfkg
smeewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqteshav
kivveaarrll

Timeline for d1t0ub_:

• d1t0ub_ first appeared in SCOP 1.67
  
• d1t0ub_ appears in SCOP 1.71
  
• d1t0ub_ appears in SCOP 1.75
  
• d1t0ub_ appears in the current release, SCOPe 2.08