| Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
| Fold c.56: Phosphorylase/hydrolase-like [53162] (7 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.2: Purine and uridine phosphorylases [53167] (1 family) ![]() complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8 |
| Family c.56.2.1: Purine and uridine phosphorylases [53168] (6 proteins) |
| Protein Uridine phosphorylase [53176] (2 species) |
| Species Escherichia coli [TaxId:562] [53177] (13 PDB entries) also includes the PDB entry (1rxs) where protein chains are designated by both upper case and lower case letters creating problems with its processing and presentation in SCOP |
| Domain d1t0ub_: 1t0u B: [99065] |
PDB Entry: 1t0u (more details), 2.2 Å
SCOP Domain Sequences for d1t0ub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t0ub_ c.56.2.1 (B:) Uridine phosphorylase {Escherichia coli [TaxId: 562]}
ksdvfhlgltkndlqgatlaivpgdpdrvekiaalmdkpvklashrefttwraeldgkpv
ivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslh
faplefpavadfecttalveaaksigatthvgvtassdtfypgqerydtysgrvvrhfkg
smeewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqteshav
kivveaarrll
Timeline for d1t0ub_: