Lineage for d1t0ga_ (1t0g A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2973074Fold d.120: Cytochrome b5-like heme/steroid binding domain [55855] (1 superfamily)
    beta-alpha-beta(2)-alpha(1,2)-(beta)-alpha(2)-beta; 3 layers: a/b/a; antiparallel beta-sheet, order: 1532(4)
  4. 2973075Superfamily d.120.1: Cytochrome b5-like heme/steroid binding domain [55856] (3 families) (S)
  5. 2973183Family d.120.1.2: Steroid-binding domain [103222] (1 protein)
  6. 2973184Protein Putative steroid binding protein AT2G24940 [103223] (1 species)
  7. 2973185Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [103224] (3 PDB entries)
  8. 2973187Domain d1t0ga_: 1t0g A: [99063]
    structural genomics

Details for d1t0ga_

PDB Entry: 1t0g (more details)

PDB Description: hypothetical protein at2g24940.1 from arabidopsis thaliana has a cytochrome b5 like fold
PDB Compounds: (A:) cytochrome b5 domain-containing protein

SCOPe Domain Sequences for d1t0ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t0ga_ d.120.1.2 (A:) Putative steroid binding protein AT2G24940 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
mghhhhhhleeftaeqlsqyngtdeskpiyvaikgrvfdvttgksfygsggdysmfagkd
asralgkmskneedvspslegltekeintlndwetkfeakypvvgrvvs

SCOPe Domain Coordinates for d1t0ga_:

Click to download the PDB-style file with coordinates for d1t0ga_.
(The format of our PDB-style files is described here.)

Timeline for d1t0ga_: