![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.120: Cytochrome b5-like heme/steroid binding domain [55855] (1 superfamily) beta-alpha-beta(2)-alpha(1,2)-(beta)-alpha(2)-beta; 3 layers: a/b/a; antiparallel beta-sheet, order: 1532(4) |
![]() | Superfamily d.120.1: Cytochrome b5-like heme/steroid binding domain [55856] (3 families) ![]() |
![]() | Family d.120.1.2: Steroid-binding domain [103222] (1 protein) |
![]() | Protein Putative steroid binding protein AT2G24940 [103223] (1 species) |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [103224] (3 PDB entries) |
![]() | Domain d1t0ga_: 1t0g A: [99063] structural genomics |
PDB Entry: 1t0g (more details)
SCOPe Domain Sequences for d1t0ga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t0ga_ d.120.1.2 (A:) Putative steroid binding protein AT2G24940 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} mghhhhhhleeftaeqlsqyngtdeskpiyvaikgrvfdvttgksfygsggdysmfagkd asralgkmskneedvspslegltekeintlndwetkfeakypvvgrvvs
Timeline for d1t0ga_: