SCOP 1.73: Domain d1t05a1: 1t05 A:430-554

Lineage for d1t05a1 (1t05 A:430-554)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (12 families)
   consists of one domain of this fold

5. Family c.55.3.1: Ribonuclease H [53099] (4 proteins)

6. Protein HIV RNase H (Domain of reverse transcriptase) [53105] (2 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (85 PDB entries)

8. Domain d1t05a1: 1t05 A:430-554 [99060]
   Other proteins in same PDB: d1t05a2, d1t05b_
   complexed with ddg, gol, mg, mrg, tnv; mutant

Details for d1t05a1

PDB Entry: 1t05, 3 Å

PDB Description: hiv-1 reverse transcriptase crosslinked to template-primer with tenofovir-diphosphate bound as the incoming nucleotide substrate

PDB Compounds: (A:) Pol polyprotein

SCOP Domain Sequences for d1t05a1:

Sequence; same for both SEQRES and ATOM records:

>d1t05a1 c.55.3.1 (A:430-554) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1 [TaxId: 11676]}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd
klvsa

Timeline for d1t05a1:

• d1t05a1 first appeared in SCOP 1.67
  
• d1t05a1 appears in SCOP 1.71
  
• d1t05a1 appears in SCOP 1.75
  
• d1t05a1 appears in the current release, SCOPe 2.08