Lineage for d1t05a1 (1t05 A:430-554)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 586264Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 586646Superfamily c.55.3: Ribonuclease H-like [53098] (10 families) (S)
    consists of one domain of this fold
  5. 586647Family c.55.3.1: Ribonuclease H [53099] (3 proteins)
  6. 586660Protein HIV RNase H (Domain of reverse transcriptase) [53105] (2 species)
  7. 586661Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (85 PDB entries)
  8. 586740Domain d1t05a1: 1t05 A:430-554 [99060]
    Other proteins in same PDB: d1t05a2, d1t05b_
    complexed with ddg, gol, mg, mrg, tnv; mutant

Details for d1t05a1

PDB Entry: 1t05 (more details), 3 Å

PDB Description: HIV-1 reverse transcriptase crosslinked to template-primer with tenofovir-diphosphate bound as the incoming nucleotide substrate

SCOP Domain Sequences for d1t05a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t05a1 c.55.3.1 (A:430-554) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd
klvsa

SCOP Domain Coordinates for d1t05a1:

Click to download the PDB-style file with coordinates for d1t05a1.
(The format of our PDB-style files is described here.)

Timeline for d1t05a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1t05a2
View in 3D
Domains from other chains:
(mouse over for more information)
d1t05b_