SCOP 1.73: Domain d1t03h2: 1t03 H:124-225

Lineage for d1t03h2 (1t03 H:124-225)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (330 PDB entries)

8. Domain d1t03h2: 1t03 H:124-225 [99057]
   Other proteins in same PDB: d1t03a1, d1t03a2, d1t03b_, d1t03h1, d1t03l1, d1t03l2
   part of Fab 28 against HIV-1 RT
   complexed with mg, mrg, tfo; mutant

Details for d1t03h2

PDB Entry: 1t03, 3.1 Å

PDB Description: hiv-1 reverse transcriptase crosslinked to tenofovir terminated template-primer (complex p)

PDB Compounds: (H:) monoclonal antibody heavy chain

SCOP Domain Sequences for d1t03h2:

Sequence; same for both SEQRES and ATOM records:

>d1t03h2 b.1.1.2 (H:124-225) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivpadc

Timeline for d1t03h2:

• d1t03h2 first appeared in SCOP 1.67
  
• d1t03h2 appears in SCOP 1.71
  
• d1t03h2 appears in SCOP 1.75
  
• d1t03h2 appears in the current release, SCOPe 2.08