Lineage for d1t03a2 (1t03 A:1-429)

  1. Root: SCOP 1.69
  2. 517079Class e: Multi-domain proteins (alpha and beta) [56572] (46 folds)
  3. 517941Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 517942Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 518049Family e.8.1.2: Reverse transcriptase [56686] (2 proteins)
  6. 518050Protein HIV-1 reverse transcriptase [56689] (2 species)
  7. 518051Species Human immunodeficiency virus type 1 [TaxId:11676] [56690] (78 PDB entries)
  8. 518181Domain d1t03a2: 1t03 A:1-429 [99054]
    Other proteins in same PDB: d1t03a1, d1t03h1, d1t03h2, d1t03l1, d1t03l2

Details for d1t03a2

PDB Entry: 1t03 (more details), 3.1 Å

PDB Description: HIV-1 reverse transcriptase crosslinked to tenofovir terminated template-primer (complex P)

SCOP Domain Sequences for d1t03a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t03a2 e.8.1.2 (A:1-429) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1}
pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdivi
yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
vqpivlpekdswtvndicklvgklnwasqiypgikvrqlskllrgtkalteviplteeae
lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
plvklwyql

SCOP Domain Coordinates for d1t03a2:

Click to download the PDB-style file with coordinates for d1t03a2.
(The format of our PDB-style files is described here.)

Timeline for d1t03a2: