Lineage for d1szxb2 (1szx B:84-198)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1411453Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 1411454Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 1411455Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins)
  6. 1411585Protein Mn superoxide dismutase (MnSOD) [54721] (9 species)
  7. 1411649Species Human (Homo sapiens) [TaxId:9606] [54724] (27 PDB entries)
  8. 1411677Domain d1szxb2: 1szx B:84-198 [99052]
    Other proteins in same PDB: d1szxa1, d1szxb1
    complexed with mn

Details for d1szxb2

PDB Entry: 1szx (more details), 1.95 Å

PDB Description: role of hydrogen bonding in the active site of human manganese superoxide dismutase
PDB Compounds: (B:) Superoxide dismutase [Mn], mitochondrial

SCOPe Domain Sequences for d1szxb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1szxb2 d.44.1.1 (B:84-198) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]}
ngggepkgelleaikrdfgsfdkfkekltaasvgvqgsgfgwlgfnkerghlqiaacpnq
dplqgttglipllgidvwehayylqyknvrpdylkaiwnvinwenvterymackk

SCOPe Domain Coordinates for d1szxb2:

Click to download the PDB-style file with coordinates for d1szxb2.
(The format of our PDB-style files is described here.)

Timeline for d1szxb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1szxb1