Lineage for d1szqb_ (1szq B:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2625930Fold e.44: 2-methylcitrate dehydratase PrpD [103377] (1 superfamily)
    consists of an all-alpha and alpha+beta domains
  4. 2625931Superfamily e.44.1: 2-methylcitrate dehydratase PrpD [103378] (1 family) (S)
    automatically mapped to Pfam PF03972
  5. 2625932Family e.44.1.1: 2-methylcitrate dehydratase PrpD [103379] (2 proteins)
  6. 2625933Protein 2-methylcitrate dehydratase PrpD [103380] (1 species)
  7. 2625934Species Escherichia coli [TaxId:562] [103381] (1 PDB entry)
  8. 2625936Domain d1szqb_: 1szq B: [99046]
    structural genomics

Details for d1szqb_

PDB Entry: 1szq (more details), 2.7 Å

PDB Description: crystal structure of 2-methylcitrate dehydratase
PDB Compounds: (B:) 2-methylcitrate dehydratase

SCOPe Domain Sequences for d1szqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1szqb_ e.44.1.1 (B:) 2-methylcitrate dehydratase PrpD {Escherichia coli [TaxId: 562]}
efdreivdivdyvmnyeisskvaydtahyclldtlgcglealeypackkllgpivpgtvv
pngvrvpgtqfqldpvqaafnigamirwldfndtwlaaewghpsdnlggilatadwlsrn
avasgkapltmkqvltamikaheiqgcialensfnrvgldhvllvkvastavvaemlglt
reeilnavslawvdgqslrtyrhapntgtrkswaagdatsravrlalmaktgemgypsal
tapvwgfydvsfkgesfrfqrpygsyvmenvlfkisfpaefhsqtaveaamtlyeqmqaa
gktaadiekvtirtheaciriidkkgplnnpadrdhciqymvaipllfgrltaadyednv
aqdkridalrekincfedpaftadyhdpekraianaitleftdgtrfeevvveypighar
rrqdgipklvdkfkinlarqfptrqqqrilevsldrarleqmpvneyldlyvi

SCOPe Domain Coordinates for d1szqb_:

Click to download the PDB-style file with coordinates for d1szqb_.
(The format of our PDB-style files is described here.)

Timeline for d1szqb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1szqa_