Lineage for d1sz8a_ (1sz8 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338840Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2338841Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2338846Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 protein domains)
    automatically mapped to Pfam PF00068
  6. 2338958Protein Snake phospholipase A2 [48624] (38 species)
  7. 2338959Species Andaman cobra (Naja sagittifera), acidic isoform 1 [TaxId:195058] [89168] (1 PDB entry)
  8. 2338960Domain d1sz8a_: 1sz8 A: [99044]
    complexed with acy, ca, po4

Details for d1sz8a_

PDB Entry: 1sz8 (more details), 1.5 Å

PDB Description: crystal structure of an acidic phospholipase a2 from naja naja sagittifera at 1.5 a resolution
PDB Compounds: (A:) Phospholipase A2 isoform 3

SCOPe Domain Sequences for d1sz8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sz8a_ a.133.1.2 (A:) Snake phospholipase A2 {Andaman cobra (Naja sagittifera), acidic isoform 1 [TaxId: 195058]}
nlyqfknmiqctvpsrswqdfadygcycgkggsgtpvddldrccqvhdncyneaenisgc
rpyfktysyectqgtltckgdnnacaasvcdcdrlaaicfagapyndanynidlkarcn

SCOPe Domain Coordinates for d1sz8a_:

Click to download the PDB-style file with coordinates for d1sz8a_.
(The format of our PDB-style files is described here.)

Timeline for d1sz8a_: