Lineage for d1sz3a_ (1sz3 A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 417356Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 417357Superfamily d.113.1: Nudix [55811] (4 families) (S)
  5. 417358Family d.113.1.1: MutT-like [55812] (10 proteins)
  6. 417405Protein Hypothetical protein DR1025 [103209] (1 species)
  7. 417406Species Deinococcus radiodurans [TaxId:1299] [103210] (4 PDB entries)
  8. 417408Domain d1sz3a_: 1sz3 A: [99042]

Details for d1sz3a_

PDB Entry: 1sz3 (more details), 1.6 Å

PDB Description: crystal structure of nudix hydrolase dr1025 in complexed with gnp and mg+2

SCOP Domain Sequences for d1sz3a_:

Sequence, based on SEQRES records: (download)

>d1sz3a_ d.113.1.1 (A:) Hypothetical protein DR1025 {Deinococcus radiodurans}
mehderthvpvelraagvvllnergdillvqekgipghpekaglwhipsgavedgenpqd
aavreaceetglrvrpvkflgaylgrfpdgvlilrhvwlaepepgqtlapaftdeiaeas
fvsredfaqlyaagqirmyqtklfyadalrekgfpalp

Sequence, based on observed residues (ATOM records): (download)

>d1sz3a_ d.113.1.1 (A:) Hypothetical protein DR1025 {Deinococcus radiodurans}
mehderthvpvelraagvvllnergdillvqekgipekaglwhipsgavedgenpqdaav
reaceetglrvrpvkflgaylgrfpdgvlilrhvwlaepepgqtlapaftdeiaeasfvs
redfaqlyaagqirmyqtklfyadalrekgfpalp

SCOP Domain Coordinates for d1sz3a_:

Click to download the PDB-style file with coordinates for d1sz3a_.
(The format of our PDB-style files is described here.)

Timeline for d1sz3a_: