Lineage for d1syta1 (1syt A:1-239,A:308-362)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 682152Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) (S)
  5. 683248Family c.1.8.5: Type II chitinase [51534] (14 proteins)
    glycosylase family 18
  6. 683408Protein Signal processing protein (SPC-40, MGP-40) [89480] (5 species)
    secreted during involution
  7. 683413Species Goat (Capra hircus) [TaxId:9925] [89481] (14 PDB entries)
  8. 683418Domain d1syta1: 1syt A:1-239,A:308-362 [99040]
    Other proteins in same PDB: d1syta2
    complexed with man, nag

Details for d1syta1

PDB Entry: 1syt (more details), 2.6 Å

PDB Description: crystal structure of signalling protein from goat spg-40 in the presense of n,n',n''-triacetyl-chitotriose at 2.6a resolution
PDB Compounds: (A:) bp40

SCOP Domain Sequences for d1syta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1syta1 c.1.8.5 (A:1-239,A:308-362) Signal processing protein (SPC-40, MGP-40) {Goat (Capra hircus) [TaxId: 9925]}
yklicyytswsqyregdgscfpdaidpflcthviysfanisnneidtwewndvtlydtln
tlknrnpklktllsvggwnfgperfskiasktqsrrtfiksvppflrthgfdgldlawly
pgrrdkrhltalvkemkaefareaqagterlllsaavsagkiaidrgydiaqisrhldfi
slltydfhgawrqtvghhsplfrgnsdassrfsnadyavsymlrlgapanklvmgiptXd
dqesvknkarylknrqlagamvwaldlddfrgtfcgqnltfpltsavkdvlarv

SCOP Domain Coordinates for d1syta1:

Click to download the PDB-style file with coordinates for d1syta1.
(The format of our PDB-style files is described here.)

Timeline for d1syta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1syta2