Lineage for d1syta1 (1syt A:1-239,A:308-362)
- Root: SCOP 1.69
Class c: Alpha and beta proteins (a/b) [51349] (136 folds) Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.8: (Trans)glycosidases [51445] (11 families) 
Family c.1.8.5: Type II chitinase [51534] (14 proteins)
glycosylase family 18
Protein Signal processing protein (SPC-40, MGP-40) [89480] (4 species)
secreted during involution
Species Goat (Capra hircus) [TaxId:9925] [89481] (3 PDB entries) 
Domain d1syta1: 1syt A:1-239,A:308-362 [99040]
Other proteins in same PDB: d1syta2
Details for d1syta1
PDB Entry: 1syt (more details), 2.6 Å
PDB Description: crystal structure of signalling protein from goat spg-40 in the presense of n,n',n''-triacetyl-chitotriose at 2.6a resolution
SCOP Domain Sequences for d1syta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1syta1 c.1.8.5 (A:1-239,A:308-362) Signal processing protein (SPC-40, MGP-40) {Goat (Capra hircus)}
yklicyytswsqyregdgscfpdaidpflcthviysfanisnneidtwewndvtlydtln
tlknrnpklktllsvggwnfgperfskiasktqsrrtfiksvppflrthgfdgldlawly
pgrrdkrhltalvkemkaefareaqagterlllsaavsagkiaidrgydiaqisrhldfi
slltydfhgawrqtvghhsplfrgnsdassrfsnadyavsymlrlgapanklvmgiptXd
dqesvknkarylknrqlagamvwaldlddfrgtfcgqnltfpltsavkdvlarv
SCOP Domain Coordinates for d1syta1:
Click to download the PDB-style file with coordinates for d1syta1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1syta1:
- d1syta1 first appeared in SCOP 1.67
- d1syta1 appears in SCOP 1.71
- d1syta1 appears in the current release, SCOPe 2.08
View in 3D
