Lineage for d1syra_ (1syr A:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 395822Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 395823Superfamily c.47.1: Thioredoxin-like [52833] (14 families) (S)
  5. 395824Family c.47.1.1: Thioltransferase [52834] (9 proteins)
  6. 395871Protein Thioredoxin [52835] (9 species)
  7. 395932Species Malarial parasite (Plasmodium falciparum) [TaxId:5833] [102431] (1 PDB entry)
  8. 395933Domain d1syra_: 1syr A: [99028]

Details for d1syra_

PDB Entry: 1syr (more details), 2.95 Å

PDB Description: initial structural analysis of plasmodium falciparum thioredoxin

SCOP Domain Sequences for d1syra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1syra_ c.47.1.1 (A:) Thioredoxin {Malarial parasite (Plasmodium falciparum)}
mvkivtsqaefdsiisqnelvivdffaewcgpckriapfyeecsktytkmvfikvdvdev
sevtekenitsmptfkvykngssvdtllgandsalkqliekya

SCOP Domain Coordinates for d1syra_:

Click to download the PDB-style file with coordinates for d1syra_.
(The format of our PDB-style files is described here.)

Timeline for d1syra_: