Lineage for d1sx8a_ (1sx8 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2121131Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2121132Superfamily c.52.1: Restriction endonuclease-like [52980] (36 families) (S)
  5. 2121148Family c.52.1.2: Restriction endonuclease EcoRV [52984] (1 protein)
    automatically mapped to Pfam PF09233
  6. 2121149Protein Restriction endonuclease EcoRV [52985] (1 species)
  7. 2121150Species Escherichia coli [TaxId:562] [52986] (30 PDB entries)
  8. 2121191Domain d1sx8a_: 1sx8 A: [99025]
    complexed with mn

Details for d1sx8a_

PDB Entry: 1sx8 (more details), 2.15 Å

PDB Description: ecorv bound to cognate dna and mn2+
PDB Compounds: (A:) Type II restriction enzyme EcoRV

SCOPe Domain Sequences for d1sx8a_:

Sequence, based on SEQRES records: (download)

>d1sx8a_ c.52.1.2 (A:) Restriction endonuclease EcoRV {Escherichia coli [TaxId: 562]}
slrsdlinalydenqkydvcgiisaegkiyplgsdtkvlstifelfsrpiinkiaekhgy
iveepkqqnhypdftlykpsepnkkiaidiattytnkenekikftlggytsfirnntkni
vypfdqyiahwiigyvytrvatrksslktyninelneipkpykgvkvflqdkwviagdla
gsgnttnigsihahykdfvegkgifdsedefldywrnyertsqlrndkynniseyrnwiy
rgrk

Sequence, based on observed residues (ATOM records): (download)

>d1sx8a_ c.52.1.2 (A:) Restriction endonuclease EcoRV {Escherichia coli [TaxId: 562]}
slrsdlinalydenqkydvcgiisaegkiyplgsdtkvlstifelfsrpiinkiaekhgy
iveepkqqnhypdftlykpsepnkkiaidiattytnkenekikftlggytsfirnntkni
vypfdqyiahwiigyvytrvksslktyninelneipkpykgvkvflqdkwviagdlagsg
nttnigsihahykdfvegkgifdsedefldywrnyertsqlrndkynniseyrnwiyrgr
k

SCOPe Domain Coordinates for d1sx8a_:

Click to download the PDB-style file with coordinates for d1sx8a_.
(The format of our PDB-style files is described here.)

Timeline for d1sx8a_: