Lineage for d1sw8a_ (1sw8 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2323235Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2323236Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2323718Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 2323778Protein Calmodulin [47516] (14 species)
  7. 2323909Species Human (Homo sapiens) [TaxId:9606] [47517] (106 PDB entries)
    Uniprot P02593
  8. 2324095Domain d1sw8a_: 1sw8 A: [99022]
    N-terminal domain only
    complexed with ca

Details for d1sw8a_

PDB Entry: 1sw8 (more details)

PDB Description: solution structure of the n-terminal domain of human n60d calmodulin refined with paramagnetism based strategy
PDB Compounds: (A:) calmodulin

SCOPe Domain Sequences for d1sw8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sw8a_ a.39.1.5 (A:) Calmodulin {Human (Homo sapiens) [TaxId: 9606]}
adqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgd
gtidfpefltmmarkmkdt

SCOPe Domain Coordinates for d1sw8a_:

Click to download the PDB-style file with coordinates for d1sw8a_.
(The format of our PDB-style files is described here.)

Timeline for d1sw8a_: