SCOP 1.71: Domain d1sv8a2: 1sv8 A:240-307

Lineage for d1sv8a2 (1sv8 A:240-307)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.3: Chitinase insertion domain [54556] (1 family)

5. Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)

6. Protein Signal processing protein (SPC-40, MGP-40) [89882] (5 species)
   secreted during involution

7. Species Sheep (Ovis aries) [TaxId:9940] [109621] (3 PDB entries)

8. Domain d1sv8a2: 1sv8 A:240-307 [99020]
   Other proteins in same PDB: d1sv8a1
   complexed with nag

Details for d1sv8a2

PDB Entry: 1sv8, 2.8 Å

PDB Description: Crystal structure of a signaling protein from buffalo(SPB-40)at 2.8 A resolution using crystals grown in the prsence of carbohydrates

SCOP Domain Sequences for d1sv8a2:

Sequence; same for both SEQRES and ATOM records:

>d1sv8a2 d.26.3.1 (A:240-307) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries)}
fgrsytlassktdvgapisgpgipgrftkwkgilayyeicdflhgatthrfrdqqvpyat
kgnqwvay

Timeline for d1sv8a2:

• d1sv8a2 first appeared in SCOP 1.67
  
• d1sv8a2 appears in SCOP 1.69
  
• d1sv8a2 last appears in SCOP 1.73