Lineage for d1sv8a1 (1sv8 A:1-239,A:308-362)
- Root: SCOP 1.73
Class c: Alpha and beta proteins (a/b) [51349] (141 folds) Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) 
Family c.1.8.5: Type II chitinase [51534] (14 proteins)
glycosylase family 18
Protein Signal processing protein (SPC-40, MGP-40) [89480] (5 species)
secreted during involution
Species Sheep (Ovis aries) [TaxId:9940] [109611] (4 PDB entries) 
Domain d1sv8a1: 1sv8 A:1-239,A:308-362 [99019]
Other proteins in same PDB: d1sv8a2
complexed with nag
Details for d1sv8a1
PDB Entry: 1sv8 (more details), 2.8 Å
PDB Description: Crystal structure of a signaling protein from buffalo(SPB-40)at 2.8 A resolution using crystals grown in the prsence of carbohydrates
PDB Compounds: (A:) signalling protein spbSCOP Domain Sequences for d1sv8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sv8a1 c.1.8.5 (A:1-239,A:308-362) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]}
yklicyytswsqyregdgscfpdaidpflcthviysfanisnneidtwewndvtlydtln
tlknrnpnlktllsvggwnygsqrfskiasktqsrrtfiksvppflrthgfdgldlawlw
pgwrdkrhlttlvkemkaefvreaqagteqlllsaavtagkiaidrgydiaqisrhldfi
slltydfhgawrqtvghhsplfrgnedassrfsnadyavsymlrlgapanklvmgiptXd
dqesvknkarylknrqlagamvwaldlddfrgtfcgqnltfpltsaikdvlarv
SCOP Domain Coordinates for d1sv8a1:
Click to download the PDB-style file with coordinates for d1sv8a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1sv8a1:
- d1sv8a1 first appeared in SCOP 1.67
- d1sv8a1 appears in SCOP 1.71
- d1sv8a1 does not appear in SCOP 1.75
View in 3D
