Lineage for d1suvf_ (1suv F:)
- Root: SCOP 1.67
Class i: Low resolution protein structures [58117] (22 folds) 
Fold i.21: Transferrin receptor-transferrin complex [103686] (1 superfamily) Superfamily i.21.1: Transferrin receptor-transferrin complex [103687] (1 family) 
Family i.21.1.1: Transferrin receptor-transferrin complex [103688] (1 protein) Protein Transferrin receptor-transferrin complex [103689] (1 species) Species Human (Homo sapiens) [TaxId:9606] [103690] (1 PDB entry) 
Domain d1suvf_: 1suv F: [99012]
Details for d1suvf_
PDB Entry: 1suv (more details), 7.5 Å
PDB Description: Structure of Human Transferrin Receptor-Transferrin Complex
SCOP Domain Sequences for d1suvf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1suvf_ i.21.1.1 (F:) Transferrin receptor-transferrin complex {Human (Homo sapiens)}
pdplqdeckavkwcalghherlkcdewsvtsggliecesaetpedciakimngeadamsl
dggyvyiagqcglvpvlaenyestdckkapeegylsvavvkksnpdinwnnlegkkscht
avdrtagwnipmgllynrinhcrfdeffrqgcapgsqknsslcelcvgpsvcapnnregy
ygytgafrclvekgdvafvksqtvlqntggrnsepwakdlkeedfellcldgtrkpvsea
hnchlakapnhavvsrkdkaacvkqklldlqvefgntvadcsskfcmfhsktkdllfrdd
tkclvdlrgkntyekylgadyikavsnlrkcstsrlleactfhkh
SCOP Domain Coordinates for d1suvf_:
Click to download the PDB-style file with coordinates for d1suvf_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1suvf_:
- d1suvf_ is new in SCOP 1.67
- d1suvf_ appears in SCOP 1.69
- d1suvf_ appears in the current release, SCOPe 2.08
View in 3D
