Lineage for d1suvb_ (1suv B:)

  1. Root: SCOP 1.67
  2. 432183Class i: Low resolution protein structures [58117] (22 folds)
  3. 433978Fold i.21: Transferrin receptor-transferrin complex [103686] (1 superfamily)
  4. 433979Superfamily i.21.1: Transferrin receptor-transferrin complex [103687] (1 family) (S)
  5. 433980Family i.21.1.1: Transferrin receptor-transferrin complex [103688] (1 protein)
  6. 433981Protein Transferrin receptor-transferrin complex [103689] (1 species)
  7. 433982Species Human (Homo sapiens) [TaxId:9606] [103690] (1 PDB entry)
  8. 433984Domain d1suvb_: 1suv B: [99008]

Details for d1suvb_

PDB Entry: 1suv (more details), 7.5 Å

PDB Description: Structure of Human Transferrin Receptor-Transferrin Complex

SCOP Domain Sequences for d1suvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1suvb_ i.21.1.1 (B:) Transferrin receptor-transferrin complex {Human (Homo sapiens)}
lywddlkrklsekldstdftstikllnensyvpreagsqkdenlalyvenefrefklskv
wrdqhfvkiqvkdsaqnsviivdkngrlvylvenpggyvayskaatvtgklvhanfgtkk
dfedlytpvngsivivragkitfaekvanaeslnaigvliymdqtkfpivnaelsffgha
hlgtgdpytpgfpsfnhtqfppsrssglpnipvqtisraaaeklfgnmegdcpsdwktds
tcrmvtsesknvkltvsnvlkeikilnifgvikgfvepdhyvvvgaqrdawgpgaaksgv
gtalllklaqmfsdmvlkdgfqpsrsiifaswsagdfgsvgatewlegylsslhlkafty
inldkavlgtsnfkvsaspllytliektmqnvkhpvtgqflyqdsnwaskvekltldnaa
fpflaysgipavsfcfcedtdypylgttmdtykelieripelnkvaraaaevagqfvikl
thdvelnldyeeynsqllsfvrdlnqyradikemglslqwlysargdffratsrlttdfg
naektdrfvmkklndrvmrveyhflspyvspkespfrhvfwgsgshtlpallenlklrkq
nngafnetlfrnqlalatwtiqgaanalsgdvwdidnef

SCOP Domain Coordinates for d1suvb_:

Click to download the PDB-style file with coordinates for d1suvb_.
(The format of our PDB-style files is described here.)

Timeline for d1suvb_: