Lineage for d1suua_ (1suu A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 468803Fold b.68: 6-bladed beta-propeller [50938] (10 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 469048Superfamily b.68.10: DNA gyrase A C-terminal domain [101904] (1 family) (S)
    beta-pinwheel, a variant of beta-propeller fold; unlike an canonical beta-propeller, strands 1 and 4 of each four-strand repeat unit are in one blade whereas strands 2 and 3 are in the next blade
  5. 469049Family b.68.10.1: DNA gyrase A C-terminal domain [101905] (1 protein)
  6. 469050Protein DNA gyrase A C-terminal domain [101906] (1 species)
  7. 469051Species Lyme disease spirochete (Borrelia burgdorferi) [TaxId:139] [101907] (1 PDB entry)
  8. 469052Domain d1suua_: 1suu A: [99006]

Details for d1suua_

PDB Entry: 1suu (more details), 1.75 Å

PDB Description: Structure of DNA gyrase A C-terminal domain

SCOP Domain Sequences for d1suua_:

Sequence, based on SEQRES records: (download)

>d1suua_ b.68.10.1 (A:) DNA gyrase A C-terminal domain {Lyme disease spirochete (Borrelia burgdorferi)}
enivvmltkkgflkrlsqneyklqgtggkglssfdlndgdeivialcvnthdylfmisne
gklylinayeikdssraskgqniselinlgdqeeiltiknskdltddaylllttasgkia
rfestdfkavksrgviviklndkdfvtsaeivfkdekviclskkgsafifnsrdvrltnr
gtqgvcgmklkegdlfvkvlsvkenpyllivsengygkrlnmskiselkrgatgytsykk
sdkkagsvvdaiavseddeillvskrskalrtvagkvseqgkdargiqvlfldndslvsv
skfi

Sequence, based on observed residues (ATOM records): (download)

>d1suua_ b.68.10.1 (A:) DNA gyrase A C-terminal domain {Lyme disease spirochete (Borrelia burgdorferi)}
enivvmltkkgflkrlsqneyklqgtggkglssfdlndgdeivialcvnthdylfmisne
gklylinayeikdqniselinlgdqeeiltiknskdltddaylllttasgkiarfestdf
kagviviklndkdfvtsaeivfkdekviclskkgsafifnsrdvrltnrgtqgvcgmklk
egdlfvkvlsvkenpyllivsengygkrlnmskiselkrgatgytsykksdkkagsvvda
iavseddeillvskrskalrtvagkvseqgkdargiqvlfldndslvsvskfi

SCOP Domain Coordinates for d1suua_:

Click to download the PDB-style file with coordinates for d1suua_.
(The format of our PDB-style files is described here.)

Timeline for d1suua_: