Lineage for d1suua_ (1suu A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2064980Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2065762Superfamily b.68.10: GyrA/ParC C-terminal domain-like [101904] (2 families) (S)
    beta-pinwheel, a variant of beta-propeller fold; unlike an canonical beta-propeller, strands 1 and 4 of each four-strand repeat unit are in one blade whereas strands 2 and 3 are in the next blade
  5. 2065763Family b.68.10.1: GyrA/ParC C-terminal domain-like [101905] (2 protein domains)
    Pfam PF03989; functional conformational changes result in breaking the interface between the N- and C-terminal blades
  6. 2065764Protein DNA gyrase A C-terminal domain [101906] (1 species)
  7. 2065765Species Lyme disease spirochete (Borrelia burgdorferi) [TaxId:139] [101907] (1 PDB entry)
  8. 2065766Domain d1suua_: 1suu A: [99006]

Details for d1suua_

PDB Entry: 1suu (more details), 1.75 Å

PDB Description: Structure of DNA gyrase A C-terminal domain
PDB Compounds: (A:) DNA gyrase subunit A

SCOPe Domain Sequences for d1suua_:

Sequence, based on SEQRES records: (download)

>d1suua_ b.68.10.1 (A:) DNA gyrase A C-terminal domain {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]}
enivvmltkkgflkrlsqneyklqgtggkglssfdlndgdeivialcvnthdylfmisne
gklylinayeikdssraskgqniselinlgdqeeiltiknskdltddaylllttasgkia
rfestdfkavksrgviviklndkdfvtsaeivfkdekviclskkgsafifnsrdvrltnr
gtqgvcgmklkegdlfvkvlsvkenpyllivsengygkrlnmskiselkrgatgytsykk
sdkkagsvvdaiavseddeillvskrskalrtvagkvseqgkdargiqvlfldndslvsv
skfi

Sequence, based on observed residues (ATOM records): (download)

>d1suua_ b.68.10.1 (A:) DNA gyrase A C-terminal domain {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]}
enivvmltkkgflkrlsqneyklqgtggkglssfdlndgdeivialcvnthdylfmisne
gklylinayeikdqniselinlgdqeeiltiknskdltddaylllttasgkiarfestdf
kagviviklndkdfvtsaeivfkdekviclskkgsafifnsrdvrltnrgtqgvcgmklk
egdlfvkvlsvkenpyllivsengygkrlnmskiselkrgatgytsykksdkkagsvvda
iavseddeillvskrskalrtvagkvseqgkdargiqvlfldndslvsvskfi

SCOPe Domain Coordinates for d1suua_:

Click to download the PDB-style file with coordinates for d1suua_.
(The format of our PDB-style files is described here.)

Timeline for d1suua_: