SCOP 1.67: Domain d1suqa2: 1suq A:1-429

Lineage for d1suqa2 (1suq A:1-429)

1. Root: SCOP 1.67

2. Class e: Multi-domain proteins (alpha and beta) [56572] (40 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.2: Reverse transcriptase [56686] (2 proteins)

6. Protein HIV-1 reverse transcriptase [56689] (2 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [56690] (71 PDB entries)

8. Domain d1suqa2: 1suq A:1-429 [99004]
   Other proteins in same PDB: d1suqa1
   complexed with 185, mg; mutant

Details for d1suqa2

PDB Entry: 1suq, 3 Å

PDB Description: crystal structure of hiv-1 reverse transcriptase (rt) in complex with janssen-r185545

SCOP Domain Sequences for d1suqa2:

Sequence; same for both SEQRES and ATOM records:

>d1suqa2 e.8.1.2 (A:1-429) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1}
pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdivi
yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlskllrgtkalteviplteeae
lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
plvklwyql

Timeline for d1suqa2:

• d1suqa2 is new in SCOP 1.67
  
• d1suqa2 appears in SCOP 1.69
  
• d1suqa2 appears in the current release, SCOPe 2.08