SCOPe 2.08: Domain d1su9b_: 1su9 B:

Lineage for d1su9b_ (1su9 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)

6. Protein Thiol-disulfide oxidoreductase ResA [102455] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [102456] (8 PDB entries)

8. Domain d1su9b_: 1su9 B: [99001]

Details for d1su9b_

PDB Entry: 1su9, 1.95 Å

PDB Description: Reduced structure of the soluble domain of ResA

PDB Compounds: (B:) Thiol-disulfide oxidoreductase resA

SCOPe Domain Sequences for d1su9b_:

Sequence; same for both SEQRES and ATOM records:

>d1su9b_ c.47.1.10 (B:) Thiol-disulfide oxidoreductase ResA {Bacillus subtilis [TaxId: 1423]}
sdapnfvledtngkrielsdlkgkgvflnfwgtwcepckkefpymanqykhfksqgveiv
avnvgeskiavhnfmksygvnfpvvldtdrqvldaydvsplpttflinpegkvvkvvtgt
mtesmihdymnlikpg

Timeline for d1su9b_:

• d1su9b_ first appeared in SCOP 1.67
  
• d1su9b_ appears in SCOPe 2.07