Lineage for d1su4a4 (1su4 A:1-124,A:240-343,A:751-994)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3028074Fold f.33: Metal cation-transporting ATPase, transmembrane domain [81666] (1 superfamily)
    core: multihelical; consists of three transmembrane regions of 2, 2 and 6 helices, separated by cytoplasmic domains
  4. 3028075Superfamily f.33.1: Metal cation-transporting ATPase, transmembrane domain [81665] (1 family) (S)
  5. 3028076Family f.33.1.1: Metal cation-transporting ATPase, transmembrane domain [81664] (2 proteins)
  6. 3028077Protein Calcium ATPase, transmembrane domain M [81663] (1 species)
    the N-terminal 40 residues interact with /form a part of transduction domain A
  7. 3028078Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81662] (42 PDB entries)
    Uniprot P04191
  8. 3028112Domain d1su4a4: 1su4 A:1-124,A:240-343,A:751-994 [98996]
    Other proteins in same PDB: d1su4a1, d1su4a2, d1su4a3
    complexed with ca, na

Details for d1su4a4

PDB Entry: 1su4 (more details), 2.4 Å

PDB Description: crystal structure of calcium atpase with two bound calcium ions
PDB Compounds: (A:) Sarcoplasmic/endoplasmic reticulum calcium ATPase 1

SCOPe Domain Sequences for d1su4a4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1su4a4 f.33.1.1 (A:1-124,A:240-343,A:751-994) Calcium ATPase, transmembrane domain M {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
meaahsksteeclayfgvsettgltpdqvkrhlekyghnelpaeegkslwelvieqfedl
lvrilllaacisfvlawfeegeetitafvepfvillilianaivgvwqernaenaiealk
eyepXaateqdktplqqkldefgeqlskvislicvavwlinighfndpvhggswirgaiy
yfkiavalavaaipeglpavittclalgtrrmakknaivrslpsvetlgXraiynnmkqf
irylissnvgevvcifltaalglpealipvqllwvnlvtdglpatalgfnppdldimdrp
prspkeplisgwlffrymaiggyvgaatvgaaawwfmyaedgpgvtyhqlthfmqctedh
phfegldceifeapepmtmalsvlvtiemcnalnslsenqslmrmppwvniwllgsicls
mslhflilyvdplpmifklkaldltqwlmvlkislpvigldeilkfiarnyleg

SCOPe Domain Coordinates for d1su4a4:

Click to download the PDB-style file with coordinates for d1su4a4.
(The format of our PDB-style files is described here.)

Timeline for d1su4a4: