![]() | Class b: All beta proteins [48724] (144 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.7: Calcium ATPase, transduction domain A [81653] (1 family) ![]() a distorted variant of double-helix |
![]() | Family b.82.7.1: Calcium ATPase, transduction domain A [81652] (1 protein) |
![]() | Protein Calcium ATPase, transduction domain A [81651] (1 species) |
![]() | Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81650] (6 PDB entries) |
![]() | Domain d1su4a1: 1su4 A:125-239 [98993] Other proteins in same PDB: d1su4a2, d1su4a3, d1su4a4 |
PDB Entry: 1su4 (more details), 2.4 Å
SCOP Domain Sequences for d1su4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1su4a1 b.82.7.1 (A:125-239) Calcium ATPase, transduction domain A {Rabbit (Oryctolagus cuniculus)} emgkvyradrksvqrikardivpgdivevavgdkvpadirilsiksttlrvdqsiltges vsvikhtepvpdpravnqdkknmlfsgtniaagkalgivattgvsteigkirdqm
Timeline for d1su4a1: