SCOPe 2.08: Domain d1su2b_: 1su2 B:

Lineage for d1su2b_ (1su2 B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.113: Nudix [55810] (1 superfamily)
   beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
   contains beta-grasp motif

4. Superfamily d.113.1: Nudix [55811] (8 families)

5. Family d.113.1.1: MutT-like [55812] (17 proteins)

6. Protein Hypothetical protein DR1025 [103209] (1 species)

7. Species Deinococcus radiodurans [TaxId:1299] [103210] (4 PDB entries)

8. Domain d1su2b_: 1su2 B: [98992]
   complexed with atp, mg

Details for d1su2b_

PDB Entry: 1su2, 1.6 Å

PDB Description: crystal structure of the nudix hydrolase dr1025 in complex with atp

PDB Compounds: (B:) MutT/nudix family protein

SCOPe Domain Sequences for d1su2b_:

Sequence; same for both SEQRES and ATOM records:

>d1su2b_ d.113.1.1 (B:) Hypothetical protein DR1025 {Deinococcus radiodurans [TaxId: 1299]}
mehderthvpvelraagvvllnergdillvqekgipghpekaglwhipsgavedgenpqd
aavreaceetglrvrpvkflgaylgrfpdgvlilrhvwlaepepgqtlapaftdeiaeas
fvsredfaqlyaagqirmyqtklfyadalrekgfpalpv

Timeline for d1su2b_:

• d1su2b_ first appeared in SCOP 1.67
  
• d1su2b_ appears in SCOPe 2.07