| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
Superfamily d.113.1: Nudix [55811] (8 families) ![]() |
| Family d.113.1.1: MutT-like [55812] (17 proteins) |
| Protein Hypothetical protein DR1025 [103209] (1 species) |
| Species Deinococcus radiodurans [TaxId:1299] [103210] (4 PDB entries) |
| Domain d1su2a_: 1su2 A: [98991] complexed with atp, mg |
PDB Entry: 1su2 (more details), 1.6 Å
SCOPe Domain Sequences for d1su2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1su2a_ d.113.1.1 (A:) Hypothetical protein DR1025 {Deinococcus radiodurans [TaxId: 1299]}
mehderthvpvelraagvvllnergdillvqekgipghpekaglwhipsgavedgenpqd
aavreaceetglrvrpvkflgaylgrfpdgvlilrhvwlaepepgqtlapaftdeiaeas
fvsredfaqlyaagqirmyqtklfyadalrekgfpalpv
Timeline for d1su2a_: