Lineage for d1stxb_ (1stx B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2136225Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2136226Superfamily c.52.1: Restriction endonuclease-like [52980] (36 families) (S)
  5. 2136242Family c.52.1.2: Restriction endonuclease EcoRV [52984] (1 protein)
    automatically mapped to Pfam PF09233
  6. 2136243Protein Restriction endonuclease EcoRV [52985] (1 species)
  7. 2136244Species Escherichia coli [TaxId:562] [52986] (30 PDB entries)
  8. 2136282Domain d1stxb_: 1stx B: [98990]
    protein/DNA complex; complexed with mn; mutant

Details for d1stxb_

PDB Entry: 1stx (more details), 2.1 Å

PDB Description: structure of the k38a mutant of ecorv bound to cognate dna and mn2+
PDB Compounds: (B:) Type II restriction enzyme EcoRV

SCOPe Domain Sequences for d1stxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1stxb_ c.52.1.2 (B:) Restriction endonuclease EcoRV {Escherichia coli [TaxId: 562]}
slrsdlinalydenqkydvcgiisaegkiyplgsdtavlstifelfsrpiinkiaekhgy
iveepkqqnhypdftlykpsepnkkiaidikttytnkenekikftlggytsfirnntkni
vypfdqyiahwiigyvytrvatrksslktyninelneipkpykgvkvflqdkwviagdla
gsgnttnigsihahykdfvegkgifdsedefldywrnyertsqlrndkynniseyrnwiy
rgrk

SCOPe Domain Coordinates for d1stxb_:

Click to download the PDB-style file with coordinates for d1stxb_.
(The format of our PDB-style files is described here.)

Timeline for d1stxb_: