SCOPe 2.07: Domain d1stxa_: 1stx A:

Lineage for d1stxa_ (1stx A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families)

5. Family c.52.1.2: Restriction endonuclease EcoRV [52984] (1 protein)
   automatically mapped to Pfam PF09233

6. Protein Restriction endonuclease EcoRV [52985] (1 species)

7. Species Escherichia coli [TaxId:562] [52986] (30 PDB entries)

8. Domain d1stxa_: 1stx A: [98989]
   protein/DNA complex; complexed with mn; mutant

Details for d1stxa_

PDB Entry: 1stx, 2.1 Å

PDB Description: structure of the k38a mutant of ecorv bound to cognate dna and mn2+

PDB Compounds: (A:) Type II restriction enzyme EcoRV

SCOPe Domain Sequences for d1stxa_:

Sequence; same for both SEQRES and ATOM records:

>d1stxa_ c.52.1.2 (A:) Restriction endonuclease EcoRV {Escherichia coli [TaxId: 562]}
slrsdlinalydenqkydvcgiisaegkiyplgsdtavlstifelfsrpiinkiaekhgy
iveepkqqnhypdftlykpsepnkkiaidikttytnkenekikftlggytsfirnntkni
vypfdqyiahwiigyvytrvatrksslktyninelneipkpykgvkvflqdkwviagdla
gsgnttnigsihahykdfvegkgifdsedefldywrnyertsqlrndkynniseyrnwiy
rgrk

Timeline for d1stxa_:

• d1stxa_ first appeared in SCOP 1.67
  
• d1stxa_ appears in SCOPe 2.06
  
• d1stxa_ appears in the current release, SCOPe 2.08