Lineage for d1stxa_ (1stx A:)
- Root: SCOP 1.67
Class c: Alpha and beta proteins (a/b) [51349] (130 folds) 
Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies)
core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the restSuperfamily c.52.1: Restriction endonuclease-like [52980] (22 families) 
Family c.52.1.2: Restriction endonuclease EcoRV [52984] (1 protein) Protein Restriction endonuclease EcoRV [52985] (1 species) Species Escherichia coli [TaxId:562] [52986] (27 PDB entries) 
Domain d1stxa_: 1stx A: [98989]
Details for d1stxa_
PDB Entry: 1stx (more details), 2.1 Å
PDB Description: structure of the k38a mutant of ecorv bound to cognate dna and mn2+
SCOP Domain Sequences for d1stxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1stxa_ c.52.1.2 (A:) Restriction endonuclease EcoRV {Escherichia coli}
slrsdlinalydenqkydvcgiisaegkiyplgsdtavlstifelfsrpiinkiaekhgy
iveepkqqnhypdftlykpsepnkkiaidikttytnkenekikftlggytsfirnntkni
vypfdqyiahwiigyvytrvatrksslktyninelneipkpykgvkvflqdkwviagdla
gsgnttnigsihahykdfvegkgifdsedefldywrnyertsqlrndkynniseyrnwiy
rgrk
SCOP Domain Coordinates for d1stxa_:
Click to download the PDB-style file with coordinates for d1stxa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1stxa_:
- d1stxa_ is new in SCOP 1.67
- d1stxa_ appears in SCOP 1.69
- d1stxa_ appears in the current release, SCOPe 2.08
View in 3D
