Lineage for d1st4a1 (1st4 A:146-337)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2929711Fold d.13: HIT-like [54196] (2 superfamilies)
    alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha
  4. 2929712Superfamily d.13.1: HIT-like [54197] (6 families) (S)
  5. 2929951Family d.13.1.3: mRNA decapping enzyme DcpS C-terminal domain [102745] (2 proteins)
  6. 2929952Protein mRNA decapping enzyme DcpS C-terminal domain [102746] (2 species)
  7. 2929953Species Human (Homo sapiens) [TaxId:9606] [102747] (5 PDB entries)
  8. 2929956Domain d1st4a1: 1st4 A:146-337 [98983]
    Other proteins in same PDB: d1st4a2, d1st4b2
    complexed with gta, yt3

Details for d1st4a1

PDB Entry: 1st4 (more details), 2.02 Å

PDB Description: structure of dcps bound to m7gpppa
PDB Compounds: (A:) mRNA decapping enzyme

SCOPe Domain Sequences for d1st4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1st4a1 d.13.1.3 (A:146-337) mRNA decapping enzyme DcpS C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
qdlrliretgddyrnitlphlesqslsiqwvynildkkaeadrivfenpdpsdgfvlipd
lkwnqqqlddlyliaichrrgirslrdltpehlpllrnilhqgqeailqryrmkgdhlrv
ylhylpsyyhlnvhftalgfeapgsgverahllaevienlecdprhyqqrtltfalradd
pllkllqeaqqs

SCOPe Domain Coordinates for d1st4a1:

Click to download the PDB-style file with coordinates for d1st4a1.
(The format of our PDB-style files is described here.)

Timeline for d1st4a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1st4a2