SCOP 1.67: Domain d1st0b1: 1st0 B:146-336

Lineage for d1st0b1 (1st0 B:146-336)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.13: HIT-like [54196] (2 superfamilies)
   alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha

4. Superfamily d.13.1: HIT-like [54197] (3 families)

5. Family d.13.1.3: mRNA decapping enzyme DcpS C-terminal domain [102745] (1 protein)

6. Protein mRNA decapping enzyme DcpS C-terminal domain [102746] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [102747] (2 PDB entries)

8. Domain d1st0b1: 1st0 B:146-336 [98981]
   Other proteins in same PDB: d1st0a2, d1st0b2
   complexed with gtg, yt3; mutant

Details for d1st0b1

PDB Entry: 1st0, 1.9 Å

PDB Description: structure of dcps bound to m7gpppg

SCOP Domain Sequences for d1st0b1:

Sequence; same for both SEQRES and ATOM records:

>d1st0b1 d.13.1.3 (B:146-336) mRNA decapping enzyme DcpS C-terminal domain {Human (Homo sapiens)}
qdlrliretgddyrnitlphlesqslsiqwvynildkkaeadrivfenpdpsdgfvlipd
lkwnqqqlddlyliaichrrgirslrdltpehlpllrnilhqgqeailqryrmkgdhlrv
ylhylpsyyhlnvhftalgfeapgsgverahllaevienlecdprhyqqrtltfalradd
pllkllqeaqq

Timeline for d1st0b1:

• d1st0b1 is new in SCOP 1.67
  
• d1st0b1 appears in SCOP 1.69
  
• d1st0b1 appears in the current release, SCOPe 2.08