Lineage for d1st0b1 (1st0 B:146-336)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 407517Fold d.13: HIT-like [54196] (2 superfamilies)
    alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha
  4. 407518Superfamily d.13.1: HIT-like [54197] (3 families) (S)
  5. 407583Family d.13.1.3: mRNA decapping enzyme DcpS C-terminal domain [102745] (1 protein)
  6. 407584Protein mRNA decapping enzyme DcpS C-terminal domain [102746] (1 species)
  7. 407585Species Human (Homo sapiens) [TaxId:9606] [102747] (2 PDB entries)
  8. 407587Domain d1st0b1: 1st0 B:146-336 [98981]
    Other proteins in same PDB: d1st0a2, d1st0b2
    complexed with gtg, yt3; mutant

Details for d1st0b1

PDB Entry: 1st0 (more details), 1.9 Å

PDB Description: structure of dcps bound to m7gpppg

SCOP Domain Sequences for d1st0b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1st0b1 d.13.1.3 (B:146-336) mRNA decapping enzyme DcpS C-terminal domain {Human (Homo sapiens)}
qdlrliretgddyrnitlphlesqslsiqwvynildkkaeadrivfenpdpsdgfvlipd
lkwnqqqlddlyliaichrrgirslrdltpehlpllrnilhqgqeailqryrmkgdhlrv
ylhylpsyyhlnvhftalgfeapgsgverahllaevienlecdprhyqqrtltfalradd
pllkllqeaqq

SCOP Domain Coordinates for d1st0b1:

Click to download the PDB-style file with coordinates for d1st0b1.
(The format of our PDB-style files is described here.)

Timeline for d1st0b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1st0b2