Lineage for d1sr3a_ (1sr3 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2791181Superfamily b.40.9: Heme chaperone CcmE [82093] (1 family) (S)
    automatically mapped to Pfam PF03100
  5. 2791182Family b.40.9.1: Heme chaperone CcmE [82094] (1 protein)
  6. 2791183Protein Heme chaperone CcmE [82095] (2 species)
  7. 2791184Species Escherichia coli [TaxId:562] [82096] (2 PDB entries)
  8. 2791186Domain d1sr3a_: 1sr3 A: [98976]

Details for d1sr3a_

PDB Entry: 1sr3 (more details)

PDB Description: solution structure of the heme chaperone ccme of escherichia coli
PDB Compounds: (A:) apo-ccme

SCOPe Domain Sequences for d1sr3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sr3a_ b.40.9.1 (A:) Heme chaperone CcmE {Escherichia coli [TaxId: 562]}
lrsnidlfytpgeilygkretqqmpevgqrlrvggmvmpgsvqrdpnslkvtftiydaeg
svdvsyegilpdlfregqgvvvqgelekgnhilakevlakhdenytppevekam

SCOPe Domain Coordinates for d1sr3a_:

Click to download the PDB-style file with coordinates for d1sr3a_.
(The format of our PDB-style files is described here.)

Timeline for d1sr3a_: