SCOPe 2.05: Domain d1sqza_: 1sqz A:

Lineage for d1sqza_ (1sqz A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
   automatically mapped to Pfam PF00068

6. Protein Snake phospholipase A2 [48624] (36 species)

7. Species Snake (Daboia russellii pulchella), different isoforms [TaxId:97228] [48630] (35 PDB entries)
   Uniprot P59071

8. Domain d1sqza_: 1sqz A: [98975]
   complexed with so4

Details for d1sqza_

PDB Entry: 1sqz, 1.2 Å

PDB Description: Design of specific inhibitors of Phopholipase A2: Crystal structure of the complex formed between Group II Phopholipase A2 and a designed peptide Dehydro-Ile-Ala-Arg-Ser at 1.2A resolution

PDB Compounds: (A:) phospholipase a2

SCOPe Domain Sequences for d1sqza_:

Sequence; same for both SEQRES and ATOM records:

>d1sqza_ a.133.1.2 (A:) Snake phospholipase A2 {Snake (Daboia russellii pulchella), different isoforms [TaxId: 97228]}
sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
c

Timeline for d1sqza_:

• d1sqza_ first appeared in SCOP 1.67
  
• d1sqza_ appears in SCOPe 2.04
  
• d1sqza_ appears in SCOPe 2.06
  
• d1sqza_ appears in the current release, SCOPe 2.08