Lineage for d1sqza_ (1sqz A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 544466Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 544467Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) (S)
  5. 544472Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)
  6. 544553Protein Snake phospholipase A2 [48624] (35 species)
  7. 544702Species Snake (Daboia russelli pulchella), different isoforms [48630] (26 PDB entries)
  8. 544707Domain d1sqza_: 1sqz A: [98975]
    complexed with cbz, so4

Details for d1sqza_

PDB Entry: 1sqz (more details), 1.2 Å

PDB Description: Design of specific inhibitors of Phopholipase A2: Crystal structure of the complex formed between Group II Phopholipase A2 and a designed peptide Dehydro-Ile-Ala-Arg-Ser at 1.2A resolution

SCOP Domain Sequences for d1sqza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqza_ a.133.1.2 (A:) Snake phospholipase A2 {Snake (Daboia russelli pulchella), different isoforms}
sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
c

SCOP Domain Coordinates for d1sqza_:

Click to download the PDB-style file with coordinates for d1sqza_.
(The format of our PDB-style files is described here.)

Timeline for d1sqza_: