Lineage for d1sqsa_ (1sqs A:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 390873Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 391125Superfamily c.23.5: Flavoproteins [52218] (6 families) (S)
  5. 391272Family c.23.5.5: Hypothetical protein SP1951 [102234] (1 protein)
  6. 391273Protein Hypothetical protein SP1951 [102235] (1 species)
  7. 391274Species (Streptococcus pneumoniae) [TaxId:1313] [102236] (1 PDB entry)
  8. 391275Domain d1sqsa_: 1sqs A: [98968]

Details for d1sqsa_

PDB Entry: 1sqs (more details), 1.5 Å

PDB Description: x-ray crystal structure protein sp1951 of streptococcus pneumoniae. northeast structural genomics consortium target spr27.

SCOP Domain Sequences for d1sqsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqsa_ c.23.5.5 (A:) Hypothetical protein SP1951 {(Streptococcus pneumoniae)}
mnkifiyagvrnhnsktleytkrlssiissrnnvdisfrtpfnseleisnsdseelfkkg
idrqsnaddggvikkellesdiiiisspvylqnvsvdtknfieriggwshlfrlagkfvv
tldvaesngsdnvseylrdifsymggqilhqvsitnslkdiaeaqlmeatykiedvlegk
ikykttdyqerayqtlklilenydsehfekmywekkrlfeansleewyyven

SCOP Domain Coordinates for d1sqsa_:

Click to download the PDB-style file with coordinates for d1sqsa_.
(The format of our PDB-style files is described here.)

Timeline for d1sqsa_: