Lineage for d1sqsa_ (1sqs A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. Family c.23.5.5: Hypothetical protein SP1951 [102234] (2 proteins)
  6. Protein Hypothetical protein SP1951 [102235] (1 species)
  7. Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [102236] (1 PDB entry)
  8. Domain d1sqsa_: 1sqs A: [98968]
    structural genomics; NESG target SPR27
    complexed with tla

Details for d1sqsa_

PDB Entry: 1sqs (more details), 1.5 Å

PDB Description: x-ray crystal structure protein sp1951 of streptococcus pneumoniae. northeast structural genomics consortium target spr27.
PDB Compounds: (A:) conserved hypothetical protein

SCOPe Domain Sequences for d1sqsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqsa_ c.23.5.5 (A:) Hypothetical protein SP1951 {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
mnkifiyagvrnhnsktleytkrlssiissrnnvdisfrtpfnseleisnsdseelfkkg
idrqsnaddggvikkellesdiiiisspvylqnvsvdtknfieriggwshlfrlagkfvv
tldvaesngsdnvseylrdifsymggqilhqvsitnslkdiaeaqlmeatykiedvlegk
ikykttdyqerayqtlklilenydsehfekmywekkrlfeansleewyyven

SCOPe Domain Coordinates for d1sqsa_ are not available.

Timeline for d1sqsa_:

Domains from other chains:
(mouse over for more information)
d1sqsb_