Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) |
Family d.108.1.5: Hypothetical protein cg14615-pa [103179] (1 protein) duplication: consists of two NAT-like domains swapped with the C-terminal strands |
Protein Hypothetical protein cg14615-pa [103180] (1 species) |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [103181] (1 PDB entry) |
Domain d1sqha_: 1sqh A: [98966] structural genomics; NESG target FR87 |
PDB Entry: 1sqh (more details), 2 Å
SCOPe Domain Sequences for d1sqha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sqha_ d.108.1.5 (A:) Hypothetical protein cg14615-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} gdilrplsdsevdelldlykvkfgirnfhylllynqrkwdrqlseaqiprndlnhislrk qfythrrgnfrtwgtyvslhrdivqsvsffswqpdgaaelwecleqtqliewtqgalltn vdlgfcnrvkelavsrgvtaiqprqcfgmvlshedafcakvpdlpsefeirrlraedaam vhdswpnkgegsltylqalvrfnkslgicrsdtgeliawifqndfsglgmlqvlpkaerr glggllaaamsreiargeeitltawivatnwrseallkrigyqkdlvnewiklvpns
Timeline for d1sqha_: