Lineage for d1sqha_ (1sqh A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968378Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2968379Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. 2968898Family d.108.1.5: Hypothetical protein cg14615-pa [103179] (1 protein)
    duplication: consists of two NAT-like domains swapped with the C-terminal strands
  6. 2968899Protein Hypothetical protein cg14615-pa [103180] (1 species)
  7. 2968900Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [103181] (1 PDB entry)
  8. 2968901Domain d1sqha_: 1sqh A: [98966]
    structural genomics; NESG target FR87

Details for d1sqha_

PDB Entry: 1sqh (more details), 2 Å

PDB Description: x-ray structure of drosophila malonogaster protein q9vr51 northeast structural genomics consortium target fr87.
PDB Compounds: (A:) hypothetical protein CG14615-PA

SCOPe Domain Sequences for d1sqha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqha_ d.108.1.5 (A:) Hypothetical protein cg14615-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
gdilrplsdsevdelldlykvkfgirnfhylllynqrkwdrqlseaqiprndlnhislrk
qfythrrgnfrtwgtyvslhrdivqsvsffswqpdgaaelwecleqtqliewtqgalltn
vdlgfcnrvkelavsrgvtaiqprqcfgmvlshedafcakvpdlpsefeirrlraedaam
vhdswpnkgegsltylqalvrfnkslgicrsdtgeliawifqndfsglgmlqvlpkaerr
glggllaaamsreiargeeitltawivatnwrseallkrigyqkdlvnewiklvpns

SCOPe Domain Coordinates for d1sqha_:

Click to download the PDB-style file with coordinates for d1sqha_.
(The format of our PDB-style files is described here.)

Timeline for d1sqha_: