Lineage for d1sqaa_ (1sqa A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2794859Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2796708Protein Urokinase-type plasminogen activator (LMW U-PA), catalytic domain [50586] (1 species)
  7. 2796709Species Human (Homo sapiens) [TaxId:9606] [50587] (101 PDB entries)
    Uniprot P00749 156-178,179-424
  8. 2796744Domain d1sqaa_: 1sqa A: [98965]
    complexed with so4, ui1

Details for d1sqaa_

PDB Entry: 1sqa (more details), 2 Å

PDB Description: Substituted 2-Naphthamidine Inhibitors of Urokinase
PDB Compounds: (A:) urokinase-type plasminogen activator

SCOPe Domain Sequences for d1sqaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqaa_ b.47.1.2 (A:) Urokinase-type plasminogen activator (LMW U-PA), catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
iiggefttienqpwfaaiyrrhrggsvtyvcggslmspcwvisathcfidypkkedyivy
lgrsrlnsntqgemkfevenlilhkdysadtlahhndiallkirskegrcaqpsrtiqti
clpsmyndpqfgtsceitgfgkeqstdylypeqlkmtvvklishrecqqphyygsevttk
mlcaadpqwktdscqgdsggplvcslqgrmtltgivswgrgcalkdkpgvytrvshflpw
irsht

SCOPe Domain Coordinates for d1sqaa_:

Click to download the PDB-style file with coordinates for d1sqaa_.
(The format of our PDB-style files is described here.)

Timeline for d1sqaa_: