SCOP 1.67: Domain d1sq6a_: 1sq6 A:

Lineage for d1sq6a_ (1sq6 A:)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (1 family)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.1: Purine and uridine phosphorylases [53168] (5 proteins)

6. Protein Putative uridine phosphorylase [102500] (1 species)

7. Species Plasmodium falciparum [102501] (3 PDB entries)

8. Domain d1sq6a_: 1sq6 A: [98964]
   complexed with so4

Details for d1sq6a_

PDB Entry: 1sq6, 2.4 Å

PDB Description: Plasmodium falciparum homolog of Uridine phosphorylase/Purine nucleoside phosphorylase

SCOP Domain Sequences for d1sq6a_:

Sequence, based on SEQRES records:

>d1sq6a_ c.56.2.1 (A:) Putative uridine phosphorylase {Plasmodium falciparum}
llrhlkiskeqitpvvlvvgdpgrvdkikvvcdsyvdlaynreyksvechykgqkflcvs
hgvgsagcavcfeelcqngakviiragscgslqpdlikrgdicicnaavredrvshllih
gdfpavgdfdvydtlnkcaqelnvpvfngisvssdmyypnkiipsrledyskanaavvem
elatlmvigtlrkvktggilivdgcpfkwdegdfdnnlvphqlenmikialgacaklatk
y

Sequence, based on observed residues (ATOM records):

>d1sq6a_ c.56.2.1 (A:) Putative uridine phosphorylase {Plasmodium falciparum}
llrhlkiskeqitpvvlvvgdpgrvdkikvvcdsyvdlaynreyksvechykgqkflcvs
hgvgsagcavcfeelcqngakviiragscgslqpdlikrgdicicnaavredrvshllih
gdfpavgdfdvydtlnkcaqelnvpvfngisvssdmyypnkiipsrledyskanaavvem
elatlmvigtlrkvktggilivdghqlenmikialgacaklatky

Timeline for d1sq6a_:

• d1sq6a_ is new in SCOP 1.67
  
• d1sq6a_ appears in SCOP 1.69
  
• d1sq6a_ appears in the current release, SCOPe 2.08